PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID AT4G00540.1
Common NameATMYB3R2, MYB3R2, MYB3R-2, PC-MYB2
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis
Family MYB
Protein Properties Length: 437aa    MW: 50032.2 Da    PI: 9.5217
Description myb domain protein 3r2
Gene Model
Gene Model ID Type Source Coding Sequence
AT4G00540.1genomeTAIRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding53.94.2e-174495148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHT....TTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmg....kgRtlkqcksrwqkyl 48
                     +g WT+eEd++l ++vk++ g++Wk+Ia++++    ++R + qc++rw+k+l
      AT4G00540.1 44 KGGWTAEEDQILTNVVKKYQGRNWKRIAECLPgseeNRRNDVQCQHRWLKVL 95
                     688**********************************************986 PP

2Myb_DNA-binding47.73.6e-15101150148
                      TSSS-HHHHHHHHHHHHHTTTT...-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGgg...tWktIartmgkgRtlkqcksrwqkyl 48 
                      +g+W +eEdell ++vk +  +    W++I+++++ gR +kqc++rw+++l
      AT4G00540.1 101 KGAWKKEEDELLSELVKDYMENdrpPWSKISKELP-GRIGKQCRERWHNHL 150
                      79******************99*************.*************97 PP

3Myb_DNA-binding50.16.6e-16156198145
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwq 45 
                      + +WT eE+++lv+a +  G++ W+ Ia+ ++ gRt++++k++w+
      AT4G00540.1 156 KSPWTREEELILVQAQRGNGNK-WAEIAKLLP-GRTENNIKNHWN 198
                      679*******************.*********.***********8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129411.8883995IPR017930Myb domain
SMARTSM007171.4E-144397IPR001005SANT/Myb domain
SuperFamilySSF466892.14E-1645118IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.601.2E-2046107IPR009057Homeodomain-like
CDDcd001672.38E-114795No hitNo description
PfamPF139211.6E-1747112No hitNo description
PROSITE profilePS5129427.38796154IPR017930Myb domain
SMARTSM007174.9E-16100152IPR001005SANT/Myb domain
CDDcd001673.53E-12103150No hitNo description
Gene3DG3DSA:1.10.10.608.9E-23108157IPR009057Homeodomain-like
SuperFamilySSF466894.05E-27130207IPR009057Homeodomain-like
PROSITE profilePS5129419.085155205IPR017930Myb domain
SMARTSM007172.1E-13155203IPR001005SANT/Myb domain
PfamPF002497.3E-14156198IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.602.7E-19158205IPR009057Homeodomain-like
CDDcd001671.35E-9158198No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006357Biological Processregulation of transcription from RNA polymerase II promoter
GO:0030154Biological Processcell differentiation
GO:0005634Cellular Componentnucleus
GO:0000981Molecular FunctionRNA polymerase II transcription factor activity, sequence-specific DNA binding
GO:0001135Molecular Functiontranscription factor activity, RNA polymerase II transcription factor recruiting
GO:0043565Molecular Functionsequence-specific DNA binding
GO:0044212Molecular Functiontranscription regulatory region DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 437 aa     Download sequence    Send to blast
MTESIDLNRS ESESDNNTDD VTPIFAIDDS SKGRVSGPTR RSTKGGWTAE EDQILTNVVK  60
KYQGRNWKRI AECLPGSEEN RRNDVQCQHR WLKVLDPSLQ KGAWKKEEDE LLSELVKDYM  120
ENDRPPWSKI SKELPGRIGK QCRERWHNHL NPTIIKSPWT REEELILVQA QRGNGNKWAE  180
IAKLLPGRTE NNIKNHWNCS VKKRLEQFPS NLFSGVVYGS KPSSGFEYNF FNQRNTMVES  240
CITSQIKEAA KSPQRDFLDL TLGLNWRSIS SSTSSLRGEE SVSSSVDSVC ARLNACLETP  300
QNSNNDTVCV KEVREMKERL RMAARTFDTP SIISKTSSPA SGLKRLRQKY DTPFPTDARS  360
HMSSEEDHSV SASPSSKYRF VKRNTCSGSK PLERRLDFDF LLWDEHGRRN GIVNFSVRIL  420
PQKSDLKSGL VRPFWLR
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1h88_C6e-52472059159MYB PROTO-ONCOGENE PROTEIN
1h89_C6e-52472059159MYB PROTO-ONCOGENE PROTEIN
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
At.37620.0seed
Expression -- Microarray ? help Back to Top
Source ID
Expression AtlasAT4G00540
AtGenExpressAT4G00540
Functional Description ? help Back to Top
Source Description
TAIREncodes a putative c-myb-like transcription factor. Member of a class of domain proteins containing structural features of the vertebrate c-Myb proto-oncoprotein, including the presence of three Myb motifs (R1,R2,R3).
Cis-element ? help Back to Top
SourceLink
PlantRegMapAT4G00540.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Phenotype -- Mutation ? help Back to Top
Source ID
T-DNA ExpressAT4G00540
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAF1516470.0AF151647.1 Arabidopsis thaliana PC-MYB2 (PC-MYB2) mRNA, complete cds.
GenBankAF2180540.0AF218054.2 Arabidopsis thaliana putative c-myb-like transcription factor (MYB3R2) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_567179.10.0myb domain protein 3r2
TrEMBLQ9SPN30.0Q9SPN3_ARATH; Myb domain protein 3r2
STRINGAT4G00540.10.0(Arabidopsis thaliana)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM16672887
Representative plantOGRP5171784
Publications ? help Back to Top
  1. Braun EL,Grotewold E
    Newly discovered plant c-myb-like genes rewrite the evolution of the plant myb gene family.
    Plant Physiol., 1999. 121(1): p. 21-4
    [PMID:10482656]
  2. Riechmann JL, et al.
    Arabidopsis transcription factors: genome-wide comparative analysis among eukaryotes.
    Science, 2000. 290(5499): p. 2105-10
    [PMID:11118137]
  3. Stracke R,Werber M,Weisshaar B
    The R2R3-MYB gene family in Arabidopsis thaliana.
    Curr. Opin. Plant Biol., 2001. 4(5): p. 447-56
    [PMID:11597504]
  4. Haga N, et al.
    R1R2R3-Myb proteins positively regulate cytokinesis through activation of KNOLLE transcription in Arabidopsis thaliana.
    Development, 2007. 134(6): p. 1101-10
    [PMID:17287251]
  5. Hanano S, et al.
    A systematic survey in Arabidopsis thaliana of transcription factors that modulate circadian parameters.
    BMC Genomics, 2008. 9: p. 182
    [PMID:18426557]
  6. Hanada K, et al.
    Functional compensation of primary and secondary metabolites by duplicate genes in Arabidopsis thaliana.
    Mol. Biol. Evol., 2011. 28(1): p. 377-82
    [PMID:20736450]
  7. Causier B,Ashworth M,Guo W,Davies B
    The TOPLESS interactome: a framework for gene repression in Arabidopsis.
    Plant Physiol., 2012. 158(1): p. 423-38
    [PMID:22065421]